Search results for "sulautettu tietotekniikka"

showing 10 items of 17 documents

Finding Software Bugs in Embedded Devices

2021

AbstractThe goal of this chapter is to introduce the reader to the domain of bug discovery in embedded systems which are at the core of the Internet of Things. Embedded software has a number of particularities which makes it slightly different to general purpose software. In particular, embedded devices are more exposed to software attacks but have lower defense levels and are often left unattended. At the same time, analyzing their security is more difficult because they are very “opaque”, while the execution of custom and embedded software is often entangled with the hardware and peripherals. These differences have an impact on our ability to find software bugs in such systems. This chapt…

021110 strategic defence & security studiessulautettu tietotekniikkaComputer sciencebusiness.industryembedded devices0211 other engineering and technologies020207 software engineering02 engineering and technologysecurityField (computer science)Domain (software engineering)Embedded softwareSoftwareSoftware bugohjelmointivirheetSoftware deploymentEmbedded systemsoftware bugs0202 electrical engineering electronic engineering information engineeringtietoturvabusinessInternet of ThingsGeneral purpose software
researchProduct

Self-management in distributed systems : smart adaptive framework for pervasive computing environments

2013

hajautetut järjestelmätself-managementsulautettu tietotekniikkaubiquitous computingautonomiset järjestelmätsemanttinen webväliohjelmistotohjelmistosuunnitteluautonomic computingpervasive computingälykkäät agentitagent-based systemohjelmistokehitysSemantic Web
researchProduct

Suomen urheilu- ja hyvinvointiteknologia-ala urheilukulttuurin muutosten ilmentäjänä

2020

Nykypäivänä urheilu- ja hyvinvointiteknologiayritykset muodostavat kansainvälisesti merkittävän kokoluokan markkinan. Alan yritykset ovat keskittyneet liiketoiminnassaan esimerkiksi anturi- ja sensoriteknologioiden tarjoamiin mahdollisuuksiin, älypuhelinsovelluksiin ja tietokoneohjelmistoihin sekä eleohjaukseen, digitaalisiin pintoihin ja tekoälyyn perustuviin liikkumisympäristöihin. Tässä tutkimuksessa selvitetään, mitkä makrotason muutosajurit ovat tehneet toimialasta Suomessa sellaisen kuin se tänä päivänä on. Samalla luodaan katsaus suomalaisten urheilu- ja hyvinvointiteknologia-alan yritysten ominaispiirteisiin. peerReviewed

iotliiketoimintamallitdata-analyysiliikuntateknologiasulautettu tietotekniikkamobiilisovellushyvinvointiteknologiayksityinen sektorisensoriteknologiateknologiayrityksetohjelmistosovellusohjelmatteknologia-alaurheilukulttuuriliikuntakulttuuriurheiluteknologiapelillistäminenurheilukulttuurin muutosubiikkiyhteiskuntakaikkiallistuminenArtikkelitpuettava teknologiadigitalisaatiotoimialaurheilu- ja hyvinvointiteknologia
researchProduct

Kannustin, koriste ja liikkujan kaveri : tutkimus liikuntateknologian käyttäjyydestä

2017

During the last couple of decades, information technology has become a ubiquitous part of almost all areas of everyday life; exercise and sports being no exception. Sports technology can be defined as digital entities, with which one can measure, record and analyse data on sports and physical activity, and refine it according to the needs of its users. This kind of technology has already been researched quite extensively. The majority of this research has concentrated on the effects of sports technology on the level of physical activity of its users, and on the adherence of users to different kinds of physical activity recommendations. In addition to this, within this research, sports techn…

liikuntateknologiasulautettu tietotekniikkaubiquitous technologyexercisesports technologykuntoliikuntakäyttäjätkäyttäjäpsykologiatoimijuususersliikuntameaningsinformation systems usagetechnology useagencysportsuser behaviour
researchProduct

Haihtumattomat tallennusmenetelmät sulautetussa anturijärjestelmässä

2006

mittaustekniikkasulautettu tietotekniikkakunnonvalvontamuistikortithaihtumattomat muistitflash-muistitkunnossapito
researchProduct

Lääkintälaitteiden kyberturvallisuuden standardit ja testaaminen

2017

Tietotekniikkaa sisältävät lääkintälaitteet pitävät meidät hengissä, jos kehomme pettää. Esimerkiksi ostoskeskuksissa olevat älykkäät defibrillaattorit antavat maallikoillekin mahdollisuuden antaa tehokasta ensiapua sydänkohtaukseen. Tietotekniikan käyttäminen lääkintälaitteissa tuo mahdollisuuksien lisäksi uhkia. Tässä tutkielmassa perehdytään siihen, miten standardit ja testaaminen edistävät kyberturvallisuutta, uhkien torjumista. Ensin tehdään katsaus kirjallisuuteen ja standardeihin ja sitten kytketään tieto käytäntöön testaamalla potilasmonitoria kirjallisuuden pohjalta. Tulos oli, että tutkittava potilasmonitori oli hyvin avoin fyysisen käyttöliittymän kautta. Esimerkiksi potilastiedo…

potilasturvallisuusembedded computingInternet of thingssulautettu tietotekniikkacyber securitycyber security standardsesineiden internetstandarditcyber security testingkyberturvallisuustestausmedical deviceslääkintälaitteet
researchProduct

Towards Seamless IoT Device-Edge-Cloud Continuum:

2021

In this paper we revisit a taxonomy of client-side IoT software architectures that we presented a few years ago. We note that the emergence of inexpensive AI/ML hardware and new communication technologies are broadening the architectural options for IoT devices even further. These options can have a significant impact on the overall end-to-end architecture and topology of IoT systems, e.g., in determining how much computation can be performed on the edge of the network. We study the implications of the IoT device architecture choices in light of the new observations, as well as make some new predictions about future directions. Additionally, we make a case for isomorphic IoT systems in whic…

software architectureIoTsulautettu tietotekniikkaprogrammable worldembedded devicesohjelmistotuotantointernet of thingsliquid softwarepilvipalvelutedge computingisomorphismreunalaskentaohjelmistoarkkitehtuuriisomorphic softwareesineiden internetsoftware engineering
researchProduct

Attacking TrustZone on devices lacking memory protection

2021

AbstractARM TrustZone offers a Trusted Execution Environment (TEE) embedded into the processor cores. Some vendors offer ARM modules that do not fully comply with TrustZone specifications, which may lead to vulnerabilities in the system. In this paper, we present a DMA attack tutorial from the insecure world onto the secure world, and the design and implementation of this attack in a real insecure hardware.

sulautettu tietotekniikkaComputational Theory and MathematicsHardware and ArchitectureComputer Science (miscellaneous)esineiden internetTrustZonesecuritytietoturvaverkkohyökkäyksetSoftwarehaavoittuvuus
researchProduct

Towards Automated Classification of Firmware Images and Identification of Embedded Devices

2017

Part 4: Operating System and Firmware Security; International audience; Embedded systems, as opposed to traditional computers, bring an incredible diversity. The number of devices manufactured is constantly increasing and each has a dedicated software, commonly known as firmware. Full firmware images are often delivered as multiple releases, correcting bugs and vulnerabilities, or adding new features. Unfortunately, there is no centralized or standardized firmware distribution mechanism. It is therefore difficult to track which vendor or device a firmware package belongs to, or to identify which firmware version is used in deployed embedded devices. At the same time, discovering devices tha…

sulautettu tietotekniikkaComputer scienceVendorvulnerability02 engineering and technologycomputer.software_genreSoftware020204 information systems0202 electrical engineering electronic engineering information engineering[INFO]Computer Science [cs]tietoturvadata securityhaavoittuvuusbusiness.industryFirmwareFingerprint (computing)020206 networking & telecommunicationsubiquitous computingRandom forestIdentification (information)koneoppiminenmachine learningEmbedded systemUser interfaceHardware_CONTROLSTRUCTURESANDMICROPROGRAMMINGbusinesscomputerPrivate network
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct